KBSG Business Solutions Center serving Fort Morgan Colorado's packaging, shipping, copying, printing, and digital imaging needs

1.67 Rating by CuteStat

kbsg.biz is 1 decade 7 years old. It is a domain having biz extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, kbsg.biz is SAFE to browse.

PageSpeed Score
92
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 11
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 97.74.144.127)

Creekside of Brentwood - Index

- creeksideofbrentwood.org

Creekside of Brentwood - Index

548,824 $ 1,200.00

راه کارگر نیوز

- rahekaregarnews.com

rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

1,387,314 $ 480.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 17 Sep 2015 05:51:10 GMT
Server: Apache
Last-Modified: Fri, 26 Jul 2013 20:25:08 GMT
ETag: "17db67f-1cfe-4e26ff05689d3"
Accept-Ranges: bytes
Content-Length: 7422
Content-Type: text/html

Domain Information

Domain Registrar: Nimzo 35, LLC
Registration Date: Jun 18, 2006, 12:00 AM 1 decade 7 years 10 months ago
Last Modified: Jun 18, 2015, 12:00 AM 8 years 10 months 3 weeks ago
Expiration Date: Jun 17, 2017, 12:00 AM 6 years 10 months 4 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited
Owner's E-Mail: sbaird@spiritofgenovia.com

Domain Nameserver Information

Host IP Address Country
ns41.domaincontrol.com 97.74.100.21 United States of America United States of America
ns42.domaincontrol.com 173.201.68.21 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
kbsg.biz A 3599 IP: 97.74.144.127
kbsg.biz NS 3599 Target: ns41.domaincontrol.com
kbsg.biz NS 3599 Target: ns42.domaincontrol.com
kbsg.biz SOA 3599 MNAME: ns41.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2013121000
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 3600
kbsg.biz MX 3599 Target: smtp.secureserver.net
kbsg.biz MX 3599 Priority: 10
Target: mailstore1.secureserver.net

Full WHOIS Lookup

Domain Name: KBSG.BIZ
Domain ID: D13741582-BIZ
Sponsoring Registrar: GODADDY.COM, INC.
Sponsoring Registrar IANA ID: 146
Registrar URL (registration services): whois.godaddy.com
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Variant: KBSG.BIZ
Registrant ID: CR19240343
Registrant Name: Stacey Baird
Registrant Organization: Karlon Entertainment
Registrant Address1: 22439 County Road W
Registrant City: Fort Morgan
Registrant State/Province: Colorado
Registrant Postal Code: 80701
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.9708675303
Registrant Email: sbaird@spiritofgenovia.com
Administrative Contact ID: CR19240345
Administrative Contact Name: Stacey Baird
Administrative Contact Organization: Karlon Entertainment
Administrative Contact Address1: 22439 County Road W
Administrative Contact City: Fort Morgan
Administrative Contact State/Province: Colorado
Administrative Contact Postal Code: 80701
Administrative Contact Country: United States
Administrative Contact Country Code: US
Administrative Contact Phone Number: +1.9708675303
Administrative Contact Email: sbaird@spiritofgenovia.com
Billing Contact ID: CR19240346
Billing Contact Name: Stacey Baird
Billing Contact Organization: Karlon Entertainment
Billing Contact Address1: 22439 County Road W
Billing Contact City: Fort Morgan
Billing Contact State/Province: Colorado
Billing Contact Postal Code: 80701
Billing Contact Country: United States
Billing Contact Country Code: US
Billing Contact Phone Number: +1.9708675303
Billing Contact Email: sbaird@spiritofgenovia.com
Technical Contact ID: CR19240344
Technical Contact Name: Stacey Baird
Technical Contact Organization: Karlon Entertainment
Technical Contact Address1: 22439 County Road W
Technical Contact City: Fort Morgan
Technical Contact State/Province: Colorado
Technical Contact Postal Code: 80701
Technical Contact Country: United States
Technical Contact Country Code: US
Technical Contact Phone Number: +1.9708675303
Technical Contact Email: sbaird@spiritofgenovia.com
Name Server: NS41.DOMAINCONTROL.COM
Name Server: NS42.DOMAINCONTROL.COM
Created by Registrar: GODADDY.COM, INC.
Last Updated by Registrar: GODADDY.COM, INC.
Domain Registration Date: Sun Jun 18 04:04:00 GMT 2006
Domain Expiration Date: Sat Jun 17 23:59:59 GMT 2017
Domain Last Updated Date: Thu Jun 18 10:50:09 GMT 2015
DNSSEC: false

>>>> Whois database was last updated on: Thu Sep 17 05:50:12 GMT 2015